Factory Directly Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

• Environmental Protection: Yes
• Color: White
• Function: Promote Digestion and Appetite
• Appearance: Powder
• Transport Package: 10vials/Box
• Specification: 10mg/vial or 20mg/vial
• Model NO.: Foxo4 D-Retro-Inverso (DRI)
• Trademark: RunYan
• Origin: Zhongguo Hangzhou
• Production Capacity: 10000kg

Product Description

Product Description

 

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRIpeptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging
Only for Reseach&Lab use.

Sequence:H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Three letter code:H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH

Product Name	FOXO4 DRI	CAS NO	616204-22-9
Molecular Formula	C228H388N86O64	Molecular Weight	5358.05
Specification	10mg	Purity	98.0%min.